SCOPe 2.08: Domain d2otab2: 2ota B:9-68

Lineage for d2otab2 (2ota B:9-68)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.284: YejL-like [158650] (1 superfamily)
   6 helices; intertwined homodimer of three-helical subunits, bundle

4. Superfamily a.284.1: YejL-like [158651] (1 family)

5. Family a.284.1.1: YejL-like [158652] (5 proteins)
   Pfam PF07208; DUF1414

6. Protein Hypothetical protein CPS2611 [158653] (1 species)

7. Species Colwellia psychrerythraea [TaxId:28229] [158654] (2 PDB entries)
   Uniprot Q481E4 7-68

8. Domain d2otab2: 2ota B:9-68 [149011]
   Other proteins in same PDB: d2otaa2, d2otab3
   automated match to d2jr2a1

Details for d2otab2

PDB Entry: 2ota, 2.2 Å

PDB Description: crystal structure of the upf0352 protein cps_2611 from colwellia psychrerythraea. nesg target csr4.

PDB Compounds: (B:) UPF0352 protein CPS_2611

SCOPe Domain Sequences for d2otab2:

Sequence; same for both SEQRES and ATOM records:

>d2otab2 a.284.1.1 (B:9-68) Hypothetical protein CPS2611 {Colwellia psychrerythraea [TaxId: 28229]}
nervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnftkalkqsv

Timeline for d2otab2:

• d2otab2 first appeared in SCOP 1.75, called d2otab1
  
• d2otab2 appears in SCOPe 2.07