SCOP 1.75: Domain d2oqmc1: 2oqm C:1-171

Lineage for d2oqmc1 (2oqm C:1-171)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order

4. Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families)
   contains metal-binding site on the bundle surface surrounded by loops

5. Family a.213.1.3: Sden0562-like [158519] (1 protein)
   Pfam PF09351; DUF1993

6. Protein Hypothetical protein Sden0562 [158520] (1 species)

7. Species Shewanella denitrificans [TaxId:192073] [158521] (1 PDB entry)
   Uniprot Q12RS4 1-171

8. Domain d2oqmc1: 2oqm C:1-171 [148994]
   automatically matched to 2OQM A:1-171
   complexed with cl, edo, fmt

Details for d2oqmc1

PDB Entry: 2oqm, 1.83 Å

PDB Description: crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution

PDB Compounds: (C:) hypothetical protein

SCOP Domain Sequences for d2oqmc1:

Sequence; same for both SEQRES and ATOM records:

>d2oqmc1 a.213.1.3 (C:1-171) Hypothetical protein Sden0562 {Shewanella denitrificans [TaxId: 192073]}
mlydltvvqfskmlknlnaifdkaeafaelkkvdmdvllnsrlaadqfnlirqvqiacdt
akvgvarltgqletapkhddsettlaelrqriasvltylegfseadfanaatiqisqprw
qgkyltgyefaiehaipnlyfhittaygilrhngvevgkkdylgampykap

Timeline for d2oqmc1:

• d2oqmc1 is new in SCOP 1.75
  
• d2oqmc1 is called d2oqmc_ in SCOPe 2.01
  
• d2oqmc1 appears in the current release, SCOPe 2.08, called d2oqmc2