SCOP 1.75: Domain d2oqjh1: 2oqj H:1-112

Lineage for d2oqjh1 (2oqj H:1-112)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)

8. Domain d2oqjh1: 2oqj H:1-112 [148988]
   Other proteins in same PDB: d2oqjb2, d2oqje2, d2oqjh2, d2oqjk2
   automatically matched to d1aqkh1

Details for d2oqjh1

PDB Entry: 2oqj, 2.8 Å

PDB Description: Crystal structure analysis of Fab 2G12 in complex with peptide 2G12.1

PDB Compounds: (H:) Fab 2G12 heavy chain

SCOP Domain Sequences for d2oqjh1:

Sequence; same for both SEQRES and ATOM records:

>d2oqjh1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
vs

Timeline for d2oqjh1:

• d2oqjh1 is new in SCOP 1.75
  
• d2oqjh1 appears in SCOPe 2.01
  
• d2oqjh1 appears in the current release, SCOPe 2.08