SCOPe 2.02: Domain d2oqje2: 2oqj E:114-228

Lineage for d2oqje2 (2oqj E:114-228)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2oqje2: 2oqj E:114-228 [148987]
   Other proteins in same PDB: d2oqjb1, d2oqje1, d2oqjh1, d2oqjk1
   automatically matched to d1aqkh2

Details for d2oqje2

PDB Entry: 2oqj, 2.8 Å

PDB Description: Crystal structure analysis of Fab 2G12 in complex with peptide 2G12.1

PDB Compounds: (E:) Fab 2G12 heavy chain

SCOPe Domain Sequences for d2oqje2:

Sequence; same for both SEQRES and ATOM records:

>d2oqje2 b.1.1.2 (E:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d2oqje2:

• d2oqje2 first appeared in SCOP 1.75
  
• d2oqje2 appears in SCOPe 2.01
  
• d2oqje2 appears in SCOPe 2.03
  
• d2oqje2 appears in the current release, SCOPe 2.08