SCOP 1.75: Domain d2oq4a2: 2oq4 A:1-124

Lineage for d2oq4a2 (2oq4 A:1-124)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family)

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)

6. Protein Endonuclease VIII [82233] (1 species)

7. Species Escherichia coli [TaxId:562] [82234] (8 PDB entries)
   Uniprot P50465

8. Domain d2oq4a2: 2oq4 A:1-124 [148979]
   Other proteins in same PDB: d2oq4a1, d2oq4a3, d2oq4b1, d2oq4b3
   automatically matched to d1k3wa2
   complexed with na, ped, so4, zn; mutant

Details for d2oq4a2

PDB Entry: 2oq4, 2.6 Å

PDB Description: crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate

PDB Compounds: (A:) Endonuclease VIII

SCOP Domain Sequences for d2oq4a2:

Sequence; same for both SEQRES and ATOM records:

>d2oq4a2 b.113.1.1 (A:1-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
pqgpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
flqr

Timeline for d2oq4a2:

• d2oq4a2 is new in SCOP 1.75
  
• d2oq4a2 appears in SCOPe 2.01
  
• d2oq4a2 appears in the current release, SCOPe 2.08