SCOPe 2.01: Domain d2ooxd_: 2oox D:

Lineage for d2ooxd_ (2oox D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.353: AMPKBI-like [160218] (1 superfamily)
   comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions

4. Superfamily d.353.1: AMPKBI-like [160219] (1 family)

5. Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
   Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region

6. Protein AMP-activated protein kinase beta subunit [160225] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160226] (3 PDB entries)
   Uniprot P78789 205-297
   Spcc1919.03c

8. Domain d2ooxd_: 2oox D: [148943]
   Other proteins in same PDB: d2ooxa1, d2ooxc_, d2ooxe1, d2ooxe2
   automated match to d2ooxb1
   complexed with amp

Details for d2ooxd_

PDB Entry: 2oox, 2.6 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with AMP

PDB Compounds: (D:) SPCC1919.03c protein

SCOPe Domain Sequences for d2ooxd_:

Sequence; same for both SEQRES and ATOM records:

>d2ooxd_ d.353.1.1 (D:) AMP-activated protein kinase beta subunit {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
seqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnh
laaantqlgvlalsattryhrkyvttamfknfd

Timeline for d2ooxd_:

• d2ooxd_ first appeared in SCOP 1.75, called d2ooxd1
  
• d2ooxd_ appears in SCOPe 2.02
  
• d2ooxd_ appears in the current release, SCOPe 2.08