Lineage for d2oocb1 (2ooc B:8-111)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765604Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (6 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 765660Family a.24.10.6: SphA-like [158394] (1 protein)
  6. 765661Protein Histidine phosphotransferase ShpA [158395] (1 species)
  7. 765662Species Caulobacter crescentus [TaxId:155892] [158396] (1 PDB entry)
    Uniprot A0EJF9 8-111
  8. 765664Domain d2oocb1: 2ooc B:8-111 [148920]
    automatically matched to 2OOC A:8-111
    complexed with gol, pg4

Details for d2oocb1

PDB Entry: 2ooc (more details), 1.52 Å

PDB Description: crystal structure of histidine phosphotransferase shpa (np_419930.1) from caulobacter crescentus at 1.52 a resolution
PDB Compounds: (B:) Histidine phosphotransferase

SCOP Domain Sequences for d2oocb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oocb1 a.24.10.6 (B:8-111) Histidine phosphotransferase ShpA {Caulobacter crescentus [TaxId: 155892]}
gavdfaylegfaagdfavvdevlalfreqaalwapmldpthpgwkdavhtvkgaargvga
fnlgevcerceagqeslegvrtaldaalldiaayaheqalrslk

SCOP Domain Coordinates for d2oocb1:

Click to download the PDB-style file with coordinates for d2oocb1.
(The format of our PDB-style files is described here.)

Timeline for d2oocb1: