Lineage for d2onsa1 (2ons A:32-342)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846619Protein Molybdate-binding protein, ModA [53883] (3 species)
  7. 846620Species Archaeoglobus fulgidus [TaxId:2234] [159807] (3 PDB entries)
    Uniprot O30142 32-342
  8. 846621Domain d2onsa1: 2ons A:32-342 [148914]
    automatically matched to 2ONK E:32-342
    complexed with mg, no3, wo4

Details for d2onsa1

PDB Entry: 2ons (more details), 1.55 Å

PDB Description: Crystal structure of A. fulgidus periplasmic binding protein ModA with bound tungstate
PDB Compounds: (A:) UPF0100 protein AF_0094

SCOP Domain Sequences for d2onsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onsa1 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]}
nvklkvfhagsltepmkafkrafeekhpnvevqteaagsaatirkvtelgrkadviatad
ytliqkmmypefanwtimfaknqivlayrndsryadeinsqnwyeilkrpdvrfgfsnpn
ddpcgyrslmaiqlaelyyndptifdelvaknsnlrfsedngsyvlrmpsserieinksk
imirsmemelihlvesgeldyffiyksvakqhgfnfvelpveidlsspdyaelyskvkvv
langkevtgkpivygitipknaenrelavefvklviseegqeilrelgqeplvppradta
vpslkamvevs

SCOP Domain Coordinates for d2onsa1:

Click to download the PDB-style file with coordinates for d2onsa1.
(The format of our PDB-style files is described here.)

Timeline for d2onsa1: