Lineage for d2onkh1 (2onk H:1-252)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888600Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 888601Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 888602Family f.58.1.1: MetI-like [161099] (5 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 888615Protein Molybdate/tungstate transport system permease protein WtpB (ModB) [161102] (1 species)
  7. 888616Species Archaeoglobus fulgidus [TaxId:2234] [161103] (1 PDB entry)
    Uniprot O30143 1-252
  8. 888619Domain d2onkh1: 2onk H:1-252 [148910]
    Other proteins in same PDB: d2onka1, d2onkb1, d2onke1, d2onkf1, d2onkg1, d2onkj1
    automatically matched to 2ONK C:1-252
    complexed with mg, po4, wo4

Details for d2onkh1

PDB Entry: 2onk (more details), 3.1 Å

PDB Description: ABC transporter ModBC in complex with its binding protein ModA
PDB Compounds: (H:) Molybdate/tungstate ABC transporter, permease protein

SCOP Domain Sequences for d2onkh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onkh1 f.58.1.1 (H:1-252) Molybdate/tungstate transport system permease protein WtpB (ModB) {Archaeoglobus fulgidus [TaxId: 2234]}
mrllfsallallssiillfvllpvaatvtlqlfnfdeflkaasdpavwkvvlttyyaali
stliavifgtplayilarksfpgksvvegivdlpvviphtvagiallvvfgssgligsfs
plkfvdalpgivvamlfvsvpiyinqakegfasvdvrlehvartlgssplrvfftvslpl
svrhivagaimswargisefgavvviayypmiaptliyerylseglsaampvaailills
lavfvalriivg

SCOP Domain Coordinates for d2onkh1:

Click to download the PDB-style file with coordinates for d2onkh1.
(The format of our PDB-style files is described here.)

Timeline for d2onkh1: