Lineage for d2onkf1 (2onk F:1-240)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831595Family c.37.1.12: ABC transporter ATPase domain-like [52686] (23 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 831739Protein Molybdate/tungstate import ATP-binding protein WtpC (ModC) [159569] (1 species)
  7. 831740Species Archaeoglobus fulgidus [TaxId:2234] [159570] (1 PDB entry)
    Uniprot O30144 1-240
  8. 831743Domain d2onkf1: 2onk F:1-240 [148908]
    Other proteins in same PDB: d2onkc1, d2onkd1, d2onke1, d2onkh1, d2onki1, d2onkj1
    automatically matched to 2ONK A:1-240
    complexed with mg, po4, wo4

Details for d2onkf1

PDB Entry: 2onk (more details), 3.1 Å

PDB Description: ABC transporter ModBC in complex with its binding protein ModA
PDB Compounds: (F:) Molybdate/tungstate ABC transporter, ATP-binding protein

SCOP Domain Sequences for d2onkf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onkf1 c.37.1.12 (F:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}
mflkvraekrlgnfrlnvdfemgrdycvllgptgagksvfleliagivkpdrgevrlnga
ditplpperrgigfvpqdyalfphlsvyrniayglrnververdrrvremaeklgiahll
drkparlsggerqrvalaralviqprlllldeplsavdlktkgvlmeelrfvqrefdvpi
lhvthdlieaamladevavmlngrivekgklkelfsakngevaeflsarnlllkvskild

SCOP Domain Coordinates for d2onkf1:

Click to download the PDB-style file with coordinates for d2onkf1.
(The format of our PDB-style files is described here.)

Timeline for d2onkf1: