Lineage for d2onkb_ (2onk B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1848535Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1848782Protein automated matches [190723] (7 species)
    not a true protein
  7. 1848783Species Archaeoglobus fulgidus [TaxId:2234] [255529] (1 PDB entry)
  8. 1848784Domain d2onkb_: 2onk B: [148904]
    Other proteins in same PDB: d2onka1, d2onkc1, d2onkd1, d2onke1, d2onkh1, d2onki1, d2onkj_
    automated match to d2onka1
    complexed with mg, po4, wo4

Details for d2onkb_

PDB Entry: 2onk (more details), 3.1 Å

PDB Description: ABC transporter ModBC in complex with its binding protein ModA
PDB Compounds: (B:) Molybdate/tungstate ABC transporter, ATP-binding protein

SCOPe Domain Sequences for d2onkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onkb_ c.37.1.12 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mflkvraekrlgnfrlnvdfemgrdycvllgptgagksvfleliagivkpdrgevrlnga
ditplpperrgigfvpqdyalfphlsvyrniayglrnververdrrvremaeklgiahll
drkparlsggerqrvalaralviqprlllldeplsavdlktkgvlmeelrfvqrefdvpi
lhvthdlieaamladevavmlngrivekgklkelfsakngevaeflsarnlllkvskild

SCOPe Domain Coordinates for d2onkb_:

Click to download the PDB-style file with coordinates for d2onkb_.
(The format of our PDB-style files is described here.)

Timeline for d2onkb_: