Lineage for d2ondb1 (2ond B:242-549)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775786Superfamily a.118.8: TPR-like [48452] (8 families) (S)
  5. 775956Family a.118.8.7: HAT/Suf repeat [158782] (1 protein)
    includes Pfam PF05843
  6. 775957Protein Cleavage stimulation factor 77 kDa subunit CSTF3 [158783] (1 species)
  7. 775958Species Mouse (Mus musculus) [TaxId:10090] [158784] (2 PDB entries)
    Uniprot Q99LI7 21-549! Uniprot Q99LI7 242-549
  8. 775960Domain d2ondb1: 2ond B:242-549 [148900]
    automatically matched to 2OND A:242-549

Details for d2ondb1

PDB Entry: 2ond (more details), 2.8 Å

PDB Description: crystal structure of the hat-c domain of murine cstf-77
PDB Compounds: (B:) Cleavage stimulation factor 77 kDa subunit

SCOP Domain Sequences for d2ondb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ondb1 a.118.8.7 (B:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}
tpqeaqqvdmwkkyiqweksnplrtedqtlitkrvmfayeqcllvlghhpdiwyeaaqyl
eqsskllaekgdmnnaklfsdeaaniyeraistllkknmllyfayadyeesrmkyekvhs
iynrllaiedidptlvyiqymkfarraegiksgrmifkkaredartrhhvyvtaalmeyy
cskdksvafkifelglkkygdipeyvlayidylshlnednntrvlfervltsgslppeks
geiwarflafesnigdlasilkvekrrftafreeyegketallvdrykfmdlypcsasel
kalgykdv

SCOP Domain Coordinates for d2ondb1:

Click to download the PDB-style file with coordinates for d2ondb1.
(The format of our PDB-style files is described here.)

Timeline for d2ondb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2onda1