SCOP 1.75: Domain d2ondb1: 2ond B:242-549

Lineage for d2ondb1 (2ond B:242-549)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (8 families)

5. Family a.118.8.7: HAT/Suf repeat [158782] (1 protein)
   includes Pfam PF05843
   this is a repeat family; one repeat unit is 2ond A:372-408 found in domain

6. Protein Cleavage stimulation factor 77 kDa subunit CSTF3 [158783] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [158784] (2 PDB entries)
   Uniprot Q99LI7 21-549! Uniprot Q99LI7 242-549

8. Domain d2ondb1: 2ond B:242-549 [148900]
   automatically matched to 2OND A:242-549

Details for d2ondb1

PDB Entry: 2ond, 2.8 Å

PDB Description: crystal structure of the hat-c domain of murine cstf-77

PDB Compounds: (B:) Cleavage stimulation factor 77 kDa subunit

SCOP Domain Sequences for d2ondb1:

Sequence; same for both SEQRES and ATOM records:

>d2ondb1 a.118.8.7 (B:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}
tpqeaqqvdmwkkyiqweksnplrtedqtlitkrvmfayeqcllvlghhpdiwyeaaqyl
eqsskllaekgdmnnaklfsdeaaniyeraistllkknmllyfayadyeesrmkyekvhs
iynrllaiedidptlvyiqymkfarraegiksgrmifkkaredartrhhvyvtaalmeyy
cskdksvafkifelglkkygdipeyvlayidylshlnednntrvlfervltsgslppeks
geiwarflafesnigdlasilkvekrrftafreeyegketallvdrykfmdlypcsasel
kalgykdv

Timeline for d2ondb1:

• d2ondb1 is new in SCOP 1.75
  
• d2ondb1 is called d2ondb_ in SCOPe 2.01
  
• d2ondb1 appears in the current release, SCOPe 2.08, called d2ondb_