SCOP 1.75: Domain d2omxb1: 2omx B:-2-101

Lineage for d2omxb1 (2omx B:-2-101)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (2 families)

5. Family b.1.6.1: Cadherin [49314] (3 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Human (Homo sapiens) [TaxId:9606] [81981] (7 PDB entries)

8. Domain d2omxb1: 2omx B:-2-101 [148887]
   Other proteins in same PDB: d2omxa1, d2omxa2
   automatically matched to d1o6sb_
   complexed with ca, cl; mutant

Details for d2omxb1

PDB Entry: 2omx, 1.7 Å

PDB Description: crystal structure of inla s192n g194s+s/hec1 complex

PDB Compounds: (B:) epithelial-cadherin

SCOP Domain Sequences for d2omxb1:

Sequence; same for both SEQRES and ATOM records:

>d2omxb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
plgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieret
gwlkvtepldreriatytlfshavssngnavedpmeilitvtdq

Timeline for d2omxb1:

• d2omxb1 is new in SCOP 1.75
  
• d2omxb1 is called d2omxb_ in SCOPe 2.01
  
• d2omxb1 appears in the current release, SCOPe 2.08, called d2omxb2