Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.24: Ribosomal protein L1 [56807] (1 superfamily) 2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1) |
Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) |
Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein) |
Protein Ribosomal protein L1 [56810] (4 species) |
Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries) |
Domain d2om7k1: 2om7 K:18-224 [148867] Other proteins in same PDB: d2om7e1, d2om7n1 automatically matched to d2j01c1 complexed with 4su, 5mc, 5mu, h2u, psu |
PDB Entry: 2om7 (more details), 7.3 Å
SCOP Domain Sequences for d2om7k1:
Sequence, based on SEQRES records: (download)
>d2om7k1 e.24.1.1 (K:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]} kvytideaarlvkelatakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlai akgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavgsklgrilgprgll pnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppekladnirafirale ahkpegakgtflrsvyvtttmgpsvri
>d2om7k1 e.24.1.1 (K:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]} kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy vtttmgpsvri
Timeline for d2om7k1: