Lineage for d2om7k1 (2om7 K:18-224)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885297Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 885298Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
  5. 885299Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 885300Protein Ribosomal protein L1 [56810] (4 species)
  7. 885311Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)
  8. 885320Domain d2om7k1: 2om7 K:18-224 [148867]
    Other proteins in same PDB: d2om7e1, d2om7n1
    automatically matched to d2j01c1
    complexed with 4su, 5mc, 5mu, h2u, psu

Details for d2om7k1

PDB Entry: 2om7 (more details), 7.3 Å

PDB Description: structural basis for interaction of the ribosome with the switch regions of gtp-bound elongation factors
PDB Compounds: (K:) 50s ribosomal protein l1

SCOP Domain Sequences for d2om7k1:

Sequence, based on SEQRES records: (download)

>d2om7k1 e.24.1.1 (K:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kvytideaarlvkelatakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlai
akgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavgsklgrilgprgll
pnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppekladnirafirale
ahkpegakgtflrsvyvtttmgpsvri

Sequence, based on observed residues (ATOM records): (download)

>d2om7k1 e.24.1.1 (K:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki
keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii
reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy
vtttmgpsvri

SCOP Domain Coordinates for d2om7k1:

Click to download the PDB-style file with coordinates for d2om7k1.
(The format of our PDB-style files is described here.)

Timeline for d2om7k1: