SCOPe 2.07: Domain d2om7e1: 2om7 E:5-128

Lineage for d2om7e1 (2om7 E:5-128)

1. Root: SCOPe 2.07

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)

8. Domain d2om7e1: 2om7 E:5-128 [148866]
   Other proteins in same PDB: d2om7k1, d2om7n1
   automatically matched to d1gixo_
   protein/RNA complex

Details for d2om7e1

PDB Entry: 2om7, 7.3 Å

PDB Description: structural basis for interaction of the ribosome with the switch regions of gtp-bound elongation factors

PDB Compounds: (E:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2om7e1:

Sequence; same for both SEQRES and ATOM records:

>d2om7e1 i.1.1.1 (E:5-128) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

Timeline for d2om7e1:

• d2om7e1 first appeared in SCOP 1.75
  
• d2om7e1 appears in SCOPe 2.06
  
• d2om7e1 appears in the current release, SCOPe 2.08