SCOP 1.75: Domain d2oi8a2: 2oi8 A:87-216

Lineage for d2oi8a2 (2oi8 A:87-216)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)

6. Protein Putative regulatory protein Sco4313 [158800] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [158801] (1 PDB entry)
   Uniprot Q9KXS8 87-216

8. Domain d2oi8a2: 2oi8 A:87-216 [148779]
   Other proteins in same PDB: d2oi8a1

Details for d2oi8a2

PDB Entry: 2oi8, 2.5 Å

PDB Description: Crystal structure of putative regulatory protein SCO4313

PDB Compounds: (A:) Putative regulatory protein SCO4313

SCOP Domain Sequences for d2oi8a2:

Sequence, based on SEQRES records:

>d2oi8a2 a.121.1.1 (A:87-216) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]}
adlaglahalrawalddpqryflifgtpvpgyrapdditeiaaetmavivdacaalppsd
gtdgafdahldthrqwagdrpapssalhralsfwsrlhgvlslelagqftgmgfdsallf
eaelkdllgp

Sequence, based on observed residues (ATOM records):

>d2oi8a2 a.121.1.1 (A:87-216) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]}
adlaglahalrawalddpqryflifgtpvpgyrapdditeiaaetmavivdacaagtdga
fdahldthrqwadrpapssalhralsfwsrlhgvlslelagqftgmgfdsallfeaelkd
llgp

Timeline for d2oi8a2:

• d2oi8a2 is new in SCOP 1.75
  
• d2oi8a2 appears in SCOPe 2.01
  
• d2oi8a2 appears in the current release, SCOPe 2.08