Lineage for d2ofyb1 (2ofy B:5-84)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768088Family a.35.1.3: SinR domain-like [47432] (8 proteins)
  6. 768121Protein Putative transcriptional regulator RHA1_ro04071 [158461] (1 species)
  7. 768122Species Rhodococcus sp. RHA1 [TaxId:101510] [158462] (1 PDB entry)
    Uniprot Q0S9B8 3-84
  8. 768124Domain d2ofyb1: 2ofy B:5-84 [148763]
    automatically matched to 2OFY A:3-84

Details for d2ofyb1

PDB Entry: 2ofy (more details), 1.7 Å

PDB Description: Crystal structure of putative XRE-family transcriptional regulator from Rhodococcus sp.
PDB Compounds: (B:) Putative XRE-family transcriptional regulator

SCOP Domain Sequences for d2ofyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofyb1 a.35.1.3 (B:5-84) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]}
pltaeelergqrlgellrsargdmsmvtvafdagisvetlrkietgriatpafftiaava
rvldlslddvaavvtfgpvs

SCOP Domain Coordinates for d2ofyb1:

Click to download the PDB-style file with coordinates for d2ofyb1.
(The format of our PDB-style files is described here.)

Timeline for d2ofyb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ofya1