SCOPe 2.01: Domain d2oeqa1: 2oeq A:3-115

Lineage for d2oeqa1 (2oeq A:3-115)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.281: YheA-like [158621] (1 superfamily)
   5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces

4. Superfamily a.281.1: YheA/YmcA-like [158622] (2 families)

5. Family a.281.1.2: YheA-like [158626] (4 proteins)
   Pfam PF06133; DUF964

6. Protein YheA-like protein [158631] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [158632] (1 PDB entry)
   Uniprot Q5L2A5 3-115

8. Domain d2oeqa1: 2oeq A:3-115 [148754]
   Other proteins in same PDB: d2oeqb_, d2oeqc_, d2oeqd_

Details for d2oeqa1

PDB Entry: 2oeq, 2.9 Å

PDB Description: protein of unknown function (duf964) from bacillus stearothermophilus

PDB Compounds: (A:) Protein of unknown function, DUF964

SCOPe Domain Sequences for d2oeqa1:

Sequence; same for both SEQRES and ATOM records:

>d2oeqa1 a.281.1.2 (A:3-115) YheA-like protein {Bacillus stearothermophilus [TaxId: 1422]}
eplhalarqleqairasepfqqlkrayedvrrdetayrmfanvrdiqlrlhekqmrgaai
lpdeieqaqkamalaqqneklarlmaleqqmsitiaevqqiamkpleelhrsf

Timeline for d2oeqa1:

• d2oeqa1 first appeared in SCOP 1.75
  
• d2oeqa1 appears in SCOPe 2.02
  
• d2oeqa1 appears in the current release, SCOPe 2.08