Lineage for d2obhb1 (2obh B:26-166)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768689Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 768749Protein Calmodulin [47516] (11 species)
  7. 768849Species Human (Homo sapiens) [TaxId:9606] [47517] (38 PDB entries)
    Uniprot P02593
  8. 768856Domain d2obhb1: 2obh B:26-166 [148717]
    automatically matched to d2ggma1
    complexed with ace, ca

Details for d2obhb1

PDB Entry: 2obh (more details), 1.8 Å

PDB Description: Centrin-XPC peptide
PDB Compounds: (B:) Centrin-2

SCOP Domain Sequences for d2obhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2obhb1 a.39.1.5 (B:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}
teeqkqeireafdlfdadgtgtidvkelkvamralgfepkkeeikkmiseidkegtgkmn
fgdfltvmtqkmsekdtkeeilkafklfdddetgkisfknlkrvakelgenltdeelqem
ideadrdgdgevseqeflrim

SCOP Domain Coordinates for d2obhb1:

Click to download the PDB-style file with coordinates for d2obhb1.
(The format of our PDB-style files is described here.)

Timeline for d2obhb1: