SCOPe 2.06: Domain d2oa8a2: 2oa8 A:5-234

Lineage for d2oa8a2 (2oa8 A:5-234)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries)

8. Domain d2oa8a2: 2oa8 A:5-234 [148693]
   Other proteins in same PDB: d2oa8a3, d2oa8b3, d2oa8b4
   automated match to d1y97a1
   protein/DNA complex; complexed with ca

Details for d2oa8a2

PDB Entry: 2oa8, 2.1 Å

PDB Description: Crystal Structure of mTREX1 with ssDNA

PDB Compounds: (A:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d2oa8a2:

Sequence, based on SEQRES records:

>d2oa8a2 c.55.3.0 (A:5-234) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvv
dklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvah
ngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiyt
rlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records):

>d2oa8a2 c.55.3.0 (A:5-234) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tlphghmqtlifldleatglpssrpevtelcllavhrralentqghpppvprpprvvdkl
slciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngd
rydfpllqtelarlstpspldgtfcvdsiaalkaleqasksyslgsiytrlywqaptdsh
taegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Timeline for d2oa8a2:

• d2oa8a2 first appeared in SCOP 1.75, called d2oa8a1
  
• d2oa8a2 was called d2oa8a_ in SCOPe 2.05
  
• d2oa8a2 appears in SCOPe 2.07
  
• d2oa8a2 appears in the current release, SCOPe 2.08