SCOPe 2.05: Domain d2oa8a_: 2oa8 A:

Lineage for d2oa8a_ (2oa8 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (30 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries)

8. Domain d2oa8a_: 2oa8 A: [148693]
   automated match to d1y97a1
   protein/DNA complex; complexed with ca

Details for d2oa8a_

PDB Entry: 2oa8, 2.1 Å

PDB Description: Crystal Structure of mTREX1 with ssDNA

PDB Compounds: (A:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d2oa8a_:

Sequence, based on SEQRES records:

>d2oa8a_ c.55.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvv
dklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvah
ngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiyt
rlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmygt

Sequence, based on observed residues (ATOM records):

>d2oa8a_ c.55.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tlphghmqtlifldleatglpssrpevtelcllavhrralentqghpppvprpprvvdkl
slciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngd
rydfpllqtelarlstpspldgtfcvdsiaalkaleqasksyslgsiytrlywqaptdsh
taegdvltllsicqwkpqallqwvdeharpfstvkpmygt

Timeline for d2oa8a_:

• d2oa8a_ first appeared in SCOP 1.75, called d2oa8a1
  
• d2oa8a_ appears in SCOPe 2.04
  
• d2oa8a_ is called d2oa8a2 in SCOPe 2.06
  
• d2oa8a_ appears in the current release, SCOPe 2.08, called d2oa8a2