Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (30 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries) |
Domain d2oa8a_: 2oa8 A: [148693] automated match to d1y97a1 protein/DNA complex; complexed with ca |
PDB Entry: 2oa8 (more details), 2.1 Å
SCOPe Domain Sequences for d2oa8a_:
Sequence, based on SEQRES records: (download)
>d2oa8a_ c.55.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvv dklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvah ngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiyt rlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmygt
>d2oa8a_ c.55.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tlphghmqtlifldleatglpssrpevtelcllavhrralentqghpppvprpprvvdkl slciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngd rydfpllqtelarlstpspldgtfcvdsiaalkaleqasksyslgsiytrlywqaptdsh taegdvltllsicqwkpqallqwvdeharpfstvkpmygt
Timeline for d2oa8a_: