Lineage for d2oa4a1 (2oa4 A:1-93)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 907718Superfamily a.4.12: TrpR-like [48295] (3 families) (S)
    contains an extra shared helix after the HTH motif
  5. 907770Family a.4.12.3: SPO1678-like [158345] (1 protein)
    Pfam PF06627; DUF1153
  6. 907771Protein Uncharacterized protein SPO1678 [158346] (1 species)
  7. 907772Species Silicibacter pomeroyi [TaxId:89184] [158347] (1 PDB entry)
    Uniprot Q5LST8 1-93
  8. 907773Domain d2oa4a1: 2oa4 A:1-93 [148690]

Details for d2oa4a1

PDB Entry: 2oa4 (more details)

PDB Description: solution nmr structure: northeast structural genomics consortium target sir5
PDB Compounds: (A:) SiR5

SCOPe Domain Sequences for d2oa4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Silicibacter pomeroyi [TaxId: 89184]}
mmflrkvegprsvtlpdgsimtradlppantrrwvasrkiavvrgviyglitlaeakqty
glsdeefnswvsalaehgkdalkvtalkkyrql

SCOPe Domain Coordinates for d2oa4a1:

Click to download the PDB-style file with coordinates for d2oa4a1.
(The format of our PDB-style files is described here.)

Timeline for d2oa4a1: