SCOPe 2.08: Domain d2o7ha2: 2o7h A:1-32

Lineage for d2o7ha2 (2o7h A:1-32)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (2 families)

5. Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)

6. Protein GCN4 [57961] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries)
   Uniprot P03069 249-279 ! Uniprot P03069 249-281

8. Domain d2o7ha2: 2o7h A:1-32 [148667]
   Other proteins in same PDB: d2o7ha3, d2o7hd2
   automated match to d2o7ha1

Details for d2o7ha2

PDB Entry: 2o7h, 1.86 Å

PDB Description: crystal structure of trimeric coiled coil gcn4 leucine zipper

PDB Compounds: (A:) General control protein GCN4

SCOPe Domain Sequences for d2o7ha2:

Sequence; same for both SEQRES and ATOM records:

>d2o7ha2 h.1.3.1 (A:1-32) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellsknyhlenrvarleklvge

Timeline for d2o7ha2:

• d2o7ha2 first appeared in SCOP 1.75, called d2o7ha1
  
• d2o7ha2 appears in SCOPe 2.07