SCOPe 2.02: Domain d2o6tk_: 2o6t K:

Lineage for d2o6tk_ (2o6t K:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein Hypothetical thioesterase PA5185 [143158] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [143159] (5 PDB entries)
   Uniprot Q9HU04 5-146

8. Domain d2o6tk_: 2o6t K: [148642]
   automated match to d2av9a1
   complexed with cl

Details for d2o6tk_

PDB Entry: 2o6t, 2.55 Å

PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- orthorhombic form (p2221).

PDB Compounds: (K:) thioesterase

SCOPe Domain Sequences for d2o6tk_:

Sequence; same for both SEQRES and ATOM records:

>d2o6tk_ d.38.1.1 (K:) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}
prplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevigl
vvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverr
ssrpvaipqelrdalaalqssaq

Timeline for d2o6tk_:

• d2o6tk_ first appeared in SCOP 1.75, called d2o6tk1
  
• d2o6tk_ appears in SCOPe 2.01
  
• d2o6tk_ appears in SCOPe 2.03
  
• d2o6tk_ appears in the current release, SCOPe 2.08