Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) |
Family d.38.1.1: 4HBT-like [54638] (18 proteins) Pfam PF03061 |
Protein Hypothetical thioesterase PA5185 [143158] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [143159] (5 PDB entries) Uniprot Q9HU04 5-146 |
Domain d2o6te1: 2o6t E:5-144 [148639] automatically matched to d2av9a1 complexed with cl |
PDB Entry: 2o6t (more details), 2.55 Å
SCOP Domain Sequences for d2o6te1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o6te1 d.38.1.1 (E:5-144) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} prplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevigl vvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverr ssrpvaipqelrdalaalqs
Timeline for d2o6te1: