Lineage for d2o5tx_ (2o5t X:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978189Protein Myoglobin [46469] (10 species)
  7. 1978194Species Horse (Equus caballus) [TaxId:9796] [46474] (84 PDB entries)
  8. 1978232Domain d2o5tx_: 2o5t X: [148615]
    automated match to d1azia_
    complexed with coh, so4

Details for d2o5tx_

PDB Entry: 2o5t (more details), 1.6 Å

PDB Description: Cobalt horse heart myoglobin, oxidized
PDB Compounds: (X:) Myoglobin

SCOPe Domain Sequences for d2o5tx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5tx_ a.1.1.2 (X:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOPe Domain Coordinates for d2o5tx_:

Click to download the PDB-style file with coordinates for d2o5tx_.
(The format of our PDB-style files is described here.)

Timeline for d2o5tx_: