SCOPe 2.08: Domain d2o5ka1: 2o5k A:35-384

Lineage for d2o5ka1 (2o5k A:35-384)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (2 species)
   CMGC group; GSK3 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [69824] (57 PDB entries)
   Uniprot P49841 35-383 ! Uniprot P49841 35-384

8. Domain d2o5ka1: 2o5k A:35-384 [148609]
   automatically matched to d1j1bb_
   complexed with hbm

Details for d2o5ka1

PDB Entry: 2o5k, 3.2 Å

PDB Description: Crystal Structure of GSK3beta in complex with a benzoimidazol inhibitor

PDB Compounds: (A:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d2o5ka1:

Sequence; same for both SEQRES and ATOM records:

>d2o5ka1 d.144.1.7 (A:35-384) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari

Timeline for d2o5ka1:

• d2o5ka1 first appeared in SCOP 1.75
  
• d2o5ka1 appears in SCOPe 2.07