SCOP 1.75: Domain d2o5ie1: 2o5i E:2-96

Lineage for d2o5ie1 (2o5i E:2-96)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (2 species)

7. Species Thermus thermophilus [TaxId:274] [161285] (1 PDB entry)

8. Domain d2o5ie1: 2o5i E:2-96 [148602]
   Other proteins in same PDB: d2o5ic1, d2o5id1, d2o5im1, d2o5in1
   automatically matched to d1hqme_
   complexed with mg, zn

Details for d2o5ie1

PDB Entry: 2o5i, 2.5 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase elongation complex

PDB Compounds: (E:) DNA-directed RNA polymerase omega chain

SCOP Domain Sequences for d2o5ie1:

Sequence; same for both SEQRES and ATOM records:

>d2o5ie1 i.8.1.1 (E:2-96) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypve

Timeline for d2o5ie1:

• d2o5ie1 is new in SCOP 1.75
  
• d2o5ie1 is called d2o5ie_ in SCOPe 2.01
  
• d2o5ie1 appears in the current release, SCOPe 2.08, called d2o5ie_