Lineage for d2o5ab_ (2o5a B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007332Family d.218.1.12: Iojap/YbeB-like [160252] (3 proteins)
    Pfam PF02410, probably has evolved a different function; closer relationship to the GrpB-like family
  6. 3007337Protein Uncharacterized protein BH1328 [160255] (1 species)
  7. 3007338Species Bacillus halodurans [TaxId:86665] [160256] (1 PDB entry)
    Uniprot Q9KD89 2-114
  8. 3007340Domain d2o5ab_: 2o5a B: [148594]
    automated match to d2o5aa1
    complexed with mn, so4

Details for d2o5ab_

PDB Entry: 2o5a (more details), 2.7 Å

PDB Description: crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21
PDB Compounds: (B:) BH1328 protein

SCOPe Domain Sequences for d2o5ab_:

Sequence, based on SEQRES records: (download)

>d2o5ab_ d.218.1.12 (B:) Uncharacterized protein BH1328 {Bacillus halodurans [TaxId: 86665]}
nqellqlavnavddkkaeqvvalnmkgisliadfflichgnsekqvqaiahelkkvaqeq
gieikrlegyeqarwvlidlgdvvvhvfhkderayynleklwgdaptvel

Sequence, based on observed residues (ATOM records): (download)

>d2o5ab_ d.218.1.12 (B:) Uncharacterized protein BH1328 {Bacillus halodurans [TaxId: 86665]}
nqellqlavnavddkkaeqvvalnmkgisldfflichgnsekqvqaiahelkkvaqeqgi
eikrlegyeqarwvlidlgdvvvhvfhkderayynleklwptvel

SCOPe Domain Coordinates for d2o5ab_:

Click to download the PDB-style file with coordinates for d2o5ab_.
(The format of our PDB-style files is described here.)

Timeline for d2o5ab_: