SCOPe 2.05: Domain d2o4ta1: 2o4t A:16-105

Lineage for d2o4ta1 (2o4t A:16-105)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.4: BH3980-like [158560] (1 family)
   automatically mapped to Pfam PF06304

5. Family a.69.4.1: BH3980-like [158561] (3 proteins)
   Pfam PF06304; DUF1048

6. Protein Uncharacterized protein BH3976 [158566] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [158567] (1 PDB entry)
   Uniprot Q9K5W1 16-105

8. Domain d2o4ta1: 2o4t A:16-105 [148590]
   complexed with peg

Details for d2o4ta1

PDB Entry: 2o4t, 1.95 Å

PDB Description: crystal structure of a protein of the duf1048 family with a left- handed superhelix fold (bh3976) from bacillus halodurans at 1.95 a resolution

PDB Compounds: (A:) BH3976 protein

SCOPe Domain Sequences for d2o4ta1:

Sequence; same for both SEQRES and ATOM records:

>d2o4ta1 a.69.4.1 (A:16-105) Uncharacterized protein BH3976 {Bacillus halodurans [TaxId: 86665]}
hvsrveklpkdyqivykeiqkylfkvgpvelnegigllseilgffeegaaagkgvldvtg
tdvaafcdaligdsktyadlyqesiqqhvd

Timeline for d2o4ta1:

• d2o4ta1 first appeared in SCOP 1.75
  
• d2o4ta1 appears in SCOPe 2.04
  
• d2o4ta1 appears in SCOPe 2.06
  
• d2o4ta1 appears in the current release, SCOPe 2.08