SCOPe 2.06: Domain d2o3lb_: 2o3l B:

Lineage for d2o3lb_ (2o3l B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.4: BH3980-like [158560] (1 family)
   automatically mapped to Pfam PF06304

5. Family a.69.4.1: BH3980-like [158561] (3 proteins)
   Pfam PF06304; DUF1048

6. Protein Hypothetical protein BCE3448 [158562] (1 species)

7. Species Bacillus cereus [TaxId:1396] [158563] (1 PDB entry)
   Uniprot Q734F7 14-95

8. Domain d2o3lb_: 2o3l B: [148580]
   Other proteins in same PDB: d2o3la2
   automated match to d2o3la1
   complexed with gol, so4

Details for d2o3lb_

PDB Entry: 2o3l, 2.05 Å

PDB Description: crystal structure of a duf1048 protein with a left-handed superhelix fold (bce_3448) from bacillus cereus atcc 10987 at 2.05 a resolution

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2o3lb_:

Sequence; same for both SEQRES and ATOM records:

>d2o3lb_ a.69.4.1 (B:) Hypothetical protein BCE3448 {Bacillus cereus [TaxId: 1396]}
eykmmmarvaalpedyqfvfkkiqnymwnfsagngmdmlhiqyelidlfeagaaegrqvl
ditgedvasfadelvanakty

Timeline for d2o3lb_:

• d2o3lb_ first appeared in SCOP 1.75, called d2o3lb1
  
• d2o3lb_ appears in SCOPe 2.05
  
• d2o3lb_ appears in SCOPe 2.07
  
• d2o3lb_ appears in the current release, SCOPe 2.08