SCOP 1.75: Domain d2o3fb1: 2o3f B:2-83

Lineage for d2o3fb1 (2o3f B:2-83)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.20: RpiR-like [158263] (1 protein)
   Pfam PF01418; contains two extra helices, one at each termini; overall arrangment of five helices is similar to the helical core of the lambda integrase-like catalytic domain ((56350))

6. Protein Putative transcriptional regulator YbbH [158264] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [158265] (1 PDB entry)
   Uniprot Q45581 1-83

8. Domain d2o3fb1: 2o3f B:2-83 [148574]
   automatically matched to 2O3F A:1-83
   complexed with mly, so4

Details for d2o3fb1

PDB Entry: 2o3f, 1.75 Å

PDB Description: Structural Genomics, the crystal structure of the N-terminal domain of the putative transcriptional regulator ybbH from Bacillus subtilis subsp. subtilis str. 168.

PDB Compounds: (B:) Putative HTH-type transcriptional regulator ybbH

SCOP Domain Sequences for d2o3fb1:

Sequence; same for both SEQRES and ATOM records:

>d2o3fb1 a.4.1.20 (B:2-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]}
atgglaiiqsmkhklppserkladyilahphkaiestvneisalanssdaavirlckslg
lkgfqdlkmrvagdlakptfqg

Timeline for d2o3fb1:

• d2o3fb1 is new in SCOP 1.75
  
• d2o3fb1 appears in SCOPe 2.01
  
• d2o3fb1 appears in the current release, SCOPe 2.08, called d2o3fb_