Lineage for d2o2lh_ (2o2l H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788746Protein automated matches [190381] (11 species)
    not a true protein
  7. 2788786Species Escherichia coli [TaxId:562] [187229] (8 PDB entries)
  8. 2788836Domain d2o2lh_: 2o2l H: [148558]
    automated match to d1b44d_

Details for d2o2lh_

PDB Entry: 2o2l (more details), 2.53 Å

PDB Description: crystal structure of human heat-labile enterotoxin in complex with a blood group a antigen analog
PDB Compounds: (H:) heat-labile enterotoxin b chain

SCOPe Domain Sequences for d2o2lh_:

Sequence, based on SEQRES records: (download)

>d2o2lh_ b.40.2.1 (H:) automated matches {Escherichia coli [TaxId: 562]}
apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismek

Sequence, based on observed residues (ATOM records): (download)

>d2o2lh_ b.40.2.1 (H:) automated matches {Escherichia coli [TaxId: 562]}
apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgssqkka
iermkdtlrityltetkidklcvwnnktpnsiaaismek

SCOPe Domain Coordinates for d2o2lh_:

Click to download the PDB-style file with coordinates for d2o2lh_.
(The format of our PDB-style files is described here.)

Timeline for d2o2lh_: