Lineage for d2o02a1 (2o02 A:1-230)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775740Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 775741Family a.118.7.1: 14-3-3 protein [48446] (4 proteins)
  6. 775757Protein zeta isoform [48449] (2 species)
  7. 775758Species Cow (Bos taurus) [TaxId:9913] [48450] (5 PDB entries)
  8. 775759Domain d2o02a1: 2o02 A:1-230 [148541]
    automatically matched to d1qjba_
    complexed with bez

Details for d2o02a1

PDB Entry: 2o02 (more details), 1.5 Å

PDB Description: phosphorylation independent interactions between 14-3-3 and exoenzyme s: from structure to pathogenesis
PDB Compounds: (A:) 14-3-3 protein zeta/delta

SCOP Domain Sequences for d2o02a1:

Sequence, based on SEQRES records: (download)

>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

Sequence, based on observed residues (ATOM records): (download)

>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqkkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkmkgdyy
rylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyeilnspe
kacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

SCOP Domain Coordinates for d2o02a1:

Click to download the PDB-style file with coordinates for d2o02a1.
(The format of our PDB-style files is described here.)

Timeline for d2o02a1: