![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (14 families) ![]() |
![]() | Family b.122.1.13: YtmB-like [159372] (1 protein) PfamB PB020780 automatically mapped to Pfam PF10763 |
![]() | Protein Hypothetical protein YtmB [159373] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [159374] (1 PDB entry) Uniprot O34365 1-80 |
![]() | Domain d2nwah_: 2nwa H: [148487] automated match to d2nwaa1 complexed with so4 |
PDB Entry: 2nwa (more details), 2.7 Å
SCOPe Domain Sequences for d2nwah_:
Sequence, based on SEQRES records: (download)
>d2nwah_ b.122.1.13 (H:) Hypothetical protein YtmB {Bacillus subtilis [TaxId: 1423]} mgmpvefntlivtkgkevrideniftlekdgyrvypmeipmdvrktkfgeksgtaevqkl qweegrtiitykltslhsvnl
>d2nwah_ b.122.1.13 (H:) Hypothetical protein YtmB {Bacillus subtilis [TaxId: 1423]} mgmpvefntlivtkgkevrideniftlekdgyrvypmeipmdvrktkfeksgtaevqklq weegrtiitykltslhsvnl
Timeline for d2nwah_: