| Class b: All beta proteins [48724] (176 folds) |
| Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) ![]() |
| Family b.122.1.13: YtmB-like [159372] (1 protein) PfamB PB020780 automatically mapped to Pfam PF10763 |
| Protein Hypothetical protein YtmB [159373] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [159374] (1 PDB entry) Uniprot O34365 1-80 |
| Domain d2nwag_: 2nwa G: [148486] automated match to d2nwaa1 complexed with so4 |
PDB Entry: 2nwa (more details), 2.7 Å
SCOPe Domain Sequences for d2nwag_:
Sequence, based on SEQRES records: (download)
>d2nwag_ b.122.1.13 (G:) Hypothetical protein YtmB {Bacillus subtilis [TaxId: 1423]}
mgmpvefntlivtkgkevrideniftlekdgyrvypmeipmdvrktkfgeksgtaevqkl
qweegrtiitykltslhsvnl
>d2nwag_ b.122.1.13 (G:) Hypothetical protein YtmB {Bacillus subtilis [TaxId: 1423]}
mgmpvefntlivtkgkevrideniftlekdgyrvypmeipmdvrktkfeksgtaevqklq
weegrtiitykltslhsvnl
Timeline for d2nwag_: