Lineage for d2nufa1 (2nuf A:2-150)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735030Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2735031Superfamily a.149.1: RNase III domain-like [69065] (3 families) (S)
  5. 2735032Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam PF00636
  6. 2735036Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 2735037Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)
  8. 2735059Domain d2nufa1: 2nuf A:2-150 [148448]
    Other proteins in same PDB: d2nufa2, d2nufb2
    automated match to d1rc7a1
    protein/RNA complex; complexed with mg

Details for d2nufa1

PDB Entry: 2nuf (more details), 2.5 Å

PDB Description: crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.5-angstrom resolution
PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d2nufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nufa1 a.149.1.1 (A:2-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg
rdanftrelfyklfkedilsaikegrvkk

SCOPe Domain Coordinates for d2nufa1:

Click to download the PDB-style file with coordinates for d2nufa1.
(The format of our PDB-style files is described here.)

Timeline for d2nufa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nufa2