Lineage for d2nuad2 (2nua D:122-287)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838358Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 1838359Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 1838366Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (5 species)
  7. 1838369Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)
  8. 1838389Domain d2nuad2: 2nua D:122-287 [148441]
    Other proteins in same PDB: d2nuaa1, d2nuab1, d2nuab2, d2nuad1, d2nuae1, d2nuae2
    automated match to d2scua2
    complexed with coa, po4, so4; mutant

Details for d2nuad2

PDB Entry: 2nua (more details), 2.95 Å

PDB Description: c123av mutant of e. coli succinyl-coa synthetase
PDB Compounds: (D:) Succinyl-CoA ligase [ADP-forming] subunit alpha

SCOPe Domain Sequences for d2nuad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuad2 c.23.4.1 (D:122-287) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
nvpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl

SCOPe Domain Coordinates for d2nuad2:

Click to download the PDB-style file with coordinates for d2nuad2.
(The format of our PDB-style files is described here.)

Timeline for d2nuad2: