Lineage for d2nu9h1 (2nu9 H:2-120)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349785Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 1349802Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (5 species)
  7. 1349805Species Escherichia coli [TaxId:562] [51902] (11 PDB entries)
  8. 1349823Domain d2nu9h1: 2nu9 H:2-120 [148432]
    Other proteins in same PDB: d2nu9a2, d2nu9b1, d2nu9b2, d2nu9d2, d2nu9e1, d2nu9e2, d2nu9f2, d2nu9g1, d2nu9g2, d2nu9h2, d2nu9i1, d2nu9i2
    automatically matched to d1oi7a1
    complexed with coa, so4; mutant

Details for d2nu9h1

PDB Entry: 2nu9 (more details), 2.9 Å

PDB Description: c123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form
PDB Compounds: (H:) Succinyl-CoA ligase [ADP-forming] subunit alpha

SCOPe Domain Sequences for d2nu9h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu9h1 c.2.1.8 (H:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}
ilidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreava
atgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig

SCOPe Domain Coordinates for d2nu9h1:

Click to download the PDB-style file with coordinates for d2nu9h1.
(The format of our PDB-style files is described here.)

Timeline for d2nu9h1: