Lineage for d2nu9f2 (2nu9 F:122-286)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158469Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 1158470Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 1158477Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (3 species)
  7. 1158478Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)
  8. 1158495Domain d2nu9f2: 2nu9 F:122-286 [148429]
    Other proteins in same PDB: d2nu9a1, d2nu9b1, d2nu9b2, d2nu9d1, d2nu9e1, d2nu9e2, d2nu9f1, d2nu9g1, d2nu9g2, d2nu9h1, d2nu9i1, d2nu9i2
    automatically matched to d1oi7a2
    complexed with coa, so4; mutant

Details for d2nu9f2

PDB Entry: 2nu9 (more details), 2.9 Å

PDB Description: c123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form
PDB Compounds: (F:) Succinyl-CoA ligase [ADP-forming] subunit alpha

SCOPe Domain Sequences for d2nu9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu9f2 c.23.4.1 (F:122-286) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
ntpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktv

SCOPe Domain Coordinates for d2nu9f2:

Click to download the PDB-style file with coordinates for d2nu9f2.
(The format of our PDB-style files is described here.)

Timeline for d2nu9f2: