Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) |
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (5 species) |
Species Escherichia coli [TaxId:562] [52213] (11 PDB entries) |
Domain d2nu9d2: 2nu9 D:122-286 [148425] Other proteins in same PDB: d2nu9a1, d2nu9b1, d2nu9b2, d2nu9d1, d2nu9e1, d2nu9e2, d2nu9f1, d2nu9g1, d2nu9g2, d2nu9h1, d2nu9i1, d2nu9i2 automatically matched to d1oi7a2 complexed with coa, so4; mutant |
PDB Entry: 2nu9 (more details), 2.9 Å
SCOPe Domain Sequences for d2nu9d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nu9d2 c.23.4.1 (D:122-286) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]} ntpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg krmghagaiiaggkgtadekfaaleaagvktvrsladigealktv
Timeline for d2nu9d2: