Lineage for d2nu8b2 (2nu8 B:1-238)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217508Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 2217509Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 2217510Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)
  8. 2217511Domain d2nu8b2: 2nu8 B:1-238 [148415]
    Other proteins in same PDB: d2nu8a1, d2nu8a2, d2nu8b1, d2nu8d1, d2nu8d2, d2nu8e1
    automated match to d1jkjb2
    complexed with coa, gol, po4, so4; mutant

Details for d2nu8b2

PDB Entry: 2nu8 (more details), 2.15 Å

PDB Description: c123at mutant of e. coli succinyl-coa synthetase
PDB Compounds: (B:) succinyl-coa synthetase beta chain

SCOPe Domain Sequences for d2nu8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu8b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOPe Domain Coordinates for d2nu8b2:

Click to download the PDB-style file with coordinates for d2nu8b2.
(The format of our PDB-style files is described here.)

Timeline for d2nu8b2: