Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) |
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species) |
Species Escherichia coli [TaxId:562] [52216] (11 PDB entries) |
Domain d2nu8b1: 2nu8 B:239-388 [148414] Other proteins in same PDB: d2nu8a1, d2nu8a2, d2nu8b2, d2nu8d1, d2nu8d2, d2nu8e2 automated match to d1jkjb1 complexed with coa, gol, po4, so4; mutant |
PDB Entry: 2nu8 (more details), 2.15 Å
SCOPe Domain Sequences for d2nu8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nu8b1 c.23.4.1 (B:239-388) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]} dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga kkladsglniiaakgltdaaqqvvaavegk
Timeline for d2nu8b1: