Lineage for d2nu7d2 (2nu7 D:122-287)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825828Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 825829Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 825836Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (3 species)
  7. 825837Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)
  8. 825839Domain d2nu7d2: 2nu7 D:122-287 [148409]
    Other proteins in same PDB: d2nu7a1, d2nu7b1, d2nu7b2, d2nu7d1, d2nu7e1, d2nu7e2
    automatically matched to d1oi7a2
    complexed with coa, po4, so4; mutant

Details for d2nu7d2

PDB Entry: 2nu7 (more details), 2.2 Å

PDB Description: c123as mutant of e. coli succinyl-coa synthetase
PDB Compounds: (D:) Succinyl-CoA ligase [ADP-forming] subunit alpha

SCOP Domain Sequences for d2nu7d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu7d2 c.23.4.1 (D:122-287) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
nspgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl

SCOP Domain Coordinates for d2nu7d2:

Click to download the PDB-style file with coordinates for d2nu7d2.
(The format of our PDB-style files is described here.)

Timeline for d2nu7d2: