SCOP 1.75: Domain d2nu6a1: 2nu6 A:2-120

Lineage for d2nu6a1 (2nu6 A:2-120)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.8: CoA-binding domain [51900] (5 proteins)

6. Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species)

7. Species Escherichia coli [TaxId:562] [51902] (11 PDB entries)

8. Domain d2nu6a1: 2nu6 A:2-120 [148396]
   Other proteins in same PDB: d2nu6a2, d2nu6b1, d2nu6b2, d2nu6d2, d2nu6e1, d2nu6e2
   automatically matched to d1oi7a1
   complexed with coa, so4; mutant

Details for d2nu6a1

PDB Entry: 2nu6, 2.55 Å

PDB Description: c123aa mutant of e. coli succinyl-coa synthetase

PDB Compounds: (A:) Succinyl-CoA ligase [ADP-forming] subunit alpha

SCOP Domain Sequences for d2nu6a1:

Sequence; same for both SEQRES and ATOM records:

>d2nu6a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}
ilidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreava
atgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig

Timeline for d2nu6a1:

• d2nu6a1 is new in SCOP 1.75
  
• d2nu6a1 appears in SCOPe 2.01
  
• d2nu6a1 appears in the current release, SCOPe 2.08