Lineage for d2ntsp2 (2nts P:119-245)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762507Protein T-cell antigen receptor [49125] (7 species)
  7. 1762538Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)
  8. 1762549Domain d2ntsp2: 2nts P:119-245 [148393]
    Other proteins in same PDB: d2ntsa1, d2ntsa2, d2ntsp1
    automated match to d1kgce2

Details for d2ntsp2

PDB Entry: 2nts (more details), 2.4 Å

PDB Description: Crystal Structure of SEK-hVb5.1
PDB Compounds: (P:) TRBC1 protein

SCOPe Domain Sequences for d2ntsp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntsp2 b.1.1.2 (P:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgr

SCOPe Domain Coordinates for d2ntsp2:

Click to download the PDB-style file with coordinates for d2ntsp2.
(The format of our PDB-style files is described here.)

Timeline for d2ntsp2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ntsp1