![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (7 species) |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries) |
![]() | Domain d2ntsp2: 2nts P:119-245 [148393] Other proteins in same PDB: d2ntsa1, d2ntsa2, d2ntsp1 automated match to d1kgce2 |
PDB Entry: 2nts (more details), 2.4 Å
SCOPe Domain Sequences for d2ntsp2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ntsp2 b.1.1.2 (P:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgr
Timeline for d2ntsp2: