SCOPe 2.04: Domain d2ntsp1: 2nts P:3-118

Lineage for d2ntsp1 (2nts P:3-118)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2ntsp1: 2nts P:3-118 [148392]
   Other proteins in same PDB: d2ntsa1, d2ntsa2, d2ntsp2
   automated match to d1kgce1

Details for d2ntsp1

PDB Entry: 2nts, 2.4 Å

PDB Description: Crystal Structure of SEK-hVb5.1

PDB Compounds: (P:) TRBC1 protein

SCOPe Domain Sequences for d2ntsp1:

Sequence; same for both SEQRES and ATOM records:

>d2ntsp1 b.1.1.0 (P:3-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfnetqrnkgnfpg
rfsgrqfsnsrsemnvstlelgdsalylcassladrvnteaffgqgtrltvve

Timeline for d2ntsp1:

• d2ntsp1 first appeared in SCOP 1.75
  
• d2ntsp1 appears in SCOPe 2.03
  
• d2ntsp1 appears in SCOPe 2.05
  
• d2ntsp1 appears in the current release, SCOPe 2.08