SCOPe 2.03: Domain d2ntsp1: 2nts P:3-118

Lineage for d2ntsp1 (2nts P:3-118)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (32 PDB entries)

8. Domain d2ntsp1: 2nts P:3-118 [148392]
   Other proteins in same PDB: d2ntsa1, d2ntsa2, d2ntsp2
   automatically matched to d1bd2e1

Details for d2ntsp1

PDB Entry: 2nts, 2.4 Å

PDB Description: Crystal Structure of SEK-hVb5.1

PDB Compounds: (P:) TRBC1 protein

SCOPe Domain Sequences for d2ntsp1:

Sequence; same for both SEQRES and ATOM records:

>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfnetqrnkgnfpg
rfsgrqfsnsrsemnvstlelgdsalylcassladrvnteaffgqgtrltvve

Timeline for d2ntsp1:

• d2ntsp1 first appeared in SCOP 1.75
  
• d2ntsp1 appears in SCOPe 2.02
  
• d2ntsp1 appears in SCOPe 2.04
  
• d2ntsp1 appears in the current release, SCOPe 2.08