SCOPe 2.01: Domain d2nr5g_: 2nr5 G:

Lineage for d2nr5g_ (2nr5 G:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.6: SO2669-like [158418] (1 family)
   (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.6.1: SO2669-like [158419] (2 proteins)

6. Protein automated matches [190741] (1 species)
   not a true protein

7. Species Shewanella oneidensis [TaxId:211586] [187922] (1 PDB entry)

8. Domain d2nr5g_: 2nr5 G: [148355]
   Other proteins in same PDB: d2nr5a1
   automated match to d2nr5a1
   complexed with act, mpd

Details for d2nr5g_

PDB Entry: 2nr5, 1.9 Å

PDB Description: Crystal Structure of Protein of Unknown Function SO2669 from Shewanella oneidensis MR-1

PDB Compounds: (G:) Hypothetical protein SO2669

SCOPe Domain Sequences for d2nr5g_:

Sequence, based on SEQRES records:

>d2nr5g_ a.25.6.1 (G:) automated matches {Shewanella oneidensis [TaxId: 211586]}
tkkeriaiqrsmaeealgklkairqlcgaedssdssdmqeveiwtnrikeledwlwgesp
ia

Sequence, based on observed residues (ATOM records):

>d2nr5g_ a.25.6.1 (G:) automated matches {Shewanella oneidensis [TaxId: 211586]}
tkkeriaiqrsmaeealgklkairqlcgaessdmqeveiwtnrikeledwlwgespia

Timeline for d2nr5g_:

• d2nr5g_ first appeared in SCOP 1.75, called d2nr5g1
  
• d2nr5g_ appears in SCOPe 2.02
  
• d2nr5g_ appears in the current release, SCOPe 2.08